PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g00423.2.p
Common NameBRADI_2g00423, LOC100825279
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB_related
Protein Properties Length: 260aa    MW: 28594.8 Da    PI: 9.2833
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g00423.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.64.3e-162266147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      r rW+++E+e+++da  ++G + Wk+I +++  ++t  q++s+ qky
  Bradi2g00423.2.p 22 RERWSPDEHERFLDAMLRFGRD-WKKIEEHVR-TKTTVQIRSHAQKY 66
                      78******************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.22E-171672IPR009057Homeodomain-like
PROSITE profilePS5129417.5241771IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-91973IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-162169IPR006447Myb domain, plants
SMARTSM007177.6E-102169IPR001005SANT/Myb domain
PfamPF002493.6E-132266IPR001005SANT/Myb domain
CDDcd001672.42E-82467No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MEQTPPGPGK KARKPYTISR PRERWSPDEH ERFLDAMLRF GRDWKKIEEH VRTKTTVQIR  60
SHAQKYFLKV QKLGLPPHHP IRSLGMTQLQ APAGSGAVPS PMTVLHGQPH ECPPGLLQSS  120
IGWSCPGLLP ASNGKRLCLQ AGIECRSGGS SSSSSMDWAS TGTGSASEAS VDETIPLPLS  180
PDDMHFAQVY RFVGDVFDPA TPCHIEAHLQ RLKDMDAITV KTILLVLRNL EANLTAPQFE  240
PIRRLLSRYD PGRPLSGQL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003565211.11e-171PREDICTED: protein REVEILLE 6-like
TrEMBLA0A0Q3I8Y11e-171A0A0Q3I8Y1_BRADI; Uncharacterized protein
STRINGBRADI1G34840.11e-111(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36423170
Representative plantOGRP9281558
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01280.24e-45MYB_related family protein